Glucokinase_human [678783-27200]

Representation Video Format Ribbon MultiGif CA trace Ball-and-Stick

---

Other visual representations: Create new custom MPEG of this morph Color protein by motion View interpolation animated in Protein Explorer (Rotate, color, render as desired. Requires PC/Mac, Chime) Color protein by nma flexibility View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors 3D jmol viewer (NEW!)

Downloads and other analyses: Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph Download interpolation as gzip'ped NMR format PDB file Proflex Analysis Helical interaction analysis of first or last frame.

GO terms associated with structures:   [ see term descriptions ] Molecular function hexokinase activity, ATP binding Biological process glycolysis

---

Statistics generated for this morph [ help page ]

Display percentiles for rankable statistics versus morph set: check 1

Rankable statistics: 2ndCoreCAs 223 2ndCoreRMS 15.6594 2ndCoreRMSpostrefitting 13.7801 AlignedCoreCAs 224 AlignedCoreRMS 0.965949 Max2ndCoreDeviation 43.6795 MaxCoreDeviation 1.63607 MaxOverallDeviation 43.6795 Min2ndCoreDeviation 1.64198 MinCoreDeviation 0.193166 MinOverallDeviation 0.193166 RMSoverall 11.0816 kappa 21.6172 natoms 3499 nresidues 447 translation 13.8115

Other information: Hinge000X 5.1268 Hinge000Y -2.89351 Hinge000Z 5.77868 Hinge000res 178:201 Hinge000seq GLY ASP PHE GLU MET ASP VAL VAL ALA MET VAL ASN ASP THR VAL ALA THR MET ILE SER CYS TYR TYR GLU Hinge000x0dist 70.3602 NHingeWindow 24 NHinges 1 TransX 5.3988 TransY 6.31685 TransZ -11.0321 hetero   inframes 2 inputchain0 A inputchain1 A inputframe0 1v4s.pdb inputframe1 1v4t.pdb max_x_or_y 37.513 movie_id 678783-27200 movie_type Yale nhetatoms   nhets 0 nresatoms 3499 outframes 32 prelimsscore nan private N protein_name Glucokinase_human submitted-by Nalvi DUro submitted-date Tue Dec 22 20:03:25 PST 2020 submitted-email duro.computational@gmail.com x0ToCentroidDistance 75.9295 x0X -50.5484 x0Y -31.3168 x0Z -47.2166

---

Alignment of Protein Structures from Amino Acids in their SEQRES decks:

View alignment as nicely formated Alscript page (PDF format)

1>P1;1v4t.pdb.....1..MVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPED
2>P1;1v4s.pdb.....1.TLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPED

1>P1;1v4t.pdb...101.AMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISC
2>P1;1v4s.pdb...101.AMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISC

1>P1;1v4t.pdb...201.YYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMGELVRLVLLRLVDEN
2>P1;1v4s.pdb...201.YYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMGELVRLVLLRLVDEN

1>P1;1v4t.pdb...301.LLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVY
2>P1;1v4s.pdb...301.LLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVY

1>P1;1v4t.pdb...401.KLHPSFKERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKAC
2>P1;1v4s.pdb...401.KLHPSFKERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKAC

---

Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu