SIK2_Human [609928-29316]

Representation Video Format Ribbon MultiGif CA trace Ball-and-Stick

---

Other visual representations: Create new custom MPEG of this morph Color protein by motion View interpolation animated in Protein Explorer (Rotate, color, render as desired. Requires PC/Mac, Chime) Color protein by nma flexibility View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors 3D jmol viewer (NEW!)

Downloads and other analyses: Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph Download interpolation as gzip'ped NMR format PDB file Proflex Analysis Helical interaction analysis of first or last frame.

---

Statistics generated for this morph [ help page ]

Display percentiles for rankable statistics versus morph set: check 1

Rankable statistics: 2ndCoreCAs 159 2ndCoreRMS 10.3091 2ndCoreRMSpostrefitting 9.64604 AlignedCoreCAs 159 AlignedCoreRMS 0.761946 Max2ndCoreDeviation 47.6879 MaxCoreDeviation 1.26885 MaxOverallDeviation 47.6879 Min2ndCoreDeviation 1.27967 MinCoreDeviation 0.0678074 MinOverallDeviation 0.0678074 RMSoverall 7.30952 kappa 6.60423 natoms 2495 nresidues 308 translation 9.65189

Other information: Hinge000X -0.34606 Hinge000Y -1.33118 Hinge000Z -14.9641 Hinge000res 182:197 Hinge000seq ASP ILE TRP SER MET GLY VAL VAL LEU TYR VAL LEU VAL CYS GLY ALA Hinge000x0dist 66.6362 NHingeWindow 16 NHinges 1 TransX 5.61019 TransY -7.83152 TransZ -0.593323 hetero   inframes 2 inputchain0 A inputchain1 A inputframe0 webupload1.pdb inputframe1 webupload2.pdb max_x_or_y 26.26 movie_id 609928-29316 movie_type Yale nhetatoms   nhets 0 nresatoms 2495 outframes 10 prelimsscore nan private N protein_name SIK2_Human submitted-by Mingsong submitted-date Mon Dec 21 20:52:36 PST 2020 submitted-email therotyonth@163.com x0ToCentroidDistance 52.5984 x0X -9.39677 x0Y -23.5835 x0Z -46.0664

---

Alignment of Protein Structures from Amino Acids in their SEQRES decks:

View alignment as nicely formated Alscript page (PDF format)

1>P1;webupload2.pdb.....1.VGFYDIEGTLGKGNFAVVKLGRXRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDXPXIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANXGRLNE
2>P1;webupload1.pdb.....1.VGFYDIEGTLGKGNFAVVKLGRXRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDXPXIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANXGRLNE

1>P1;webupload2.pdb...101.SEARRKFWQILSAVDYCXGRKIVXRDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALP
2>P1;webupload1.pdb...101.SEARRKFWQILSAVDYCXGRKIVXRDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALP

1>P1;webupload2.pdb...201.FDGPTLPILRQRVLEGRFRIPYFMSEDCEXLIRRMLVLDPSKRLTIAQIKEXKWMLIEVPVQRPVLYPQEQENEPSIGEFNEQVLRLMXSLGIDQQKTIE
2>P1;webupload1.pdb...201.FDGPTLPILRQRVLEGRFRIPYFMSEDCEXLIRRMLVLDPSKRLTIAQIKEXKWMLIEVPVQRPVLYPQEQENEPSIGEFNEQVLRLMXSLGIDQQKTIE

1>P1;webupload2.pdb...301.SLQNKSYNXFAAIYFLLV
2>P1;webupload1.pdb...301.SLQNKSYNXFAAIYFLLV

---

Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu