glr14 [594526-7006]

Representation Video Format Ribbon MultiGif CA trace Ball-and-Stick

---

Other visual representations: Create new custom MPEG of this morph Color protein by motion View interpolation animated in Protein Explorer (Rotate, color, render as desired. Requires PC/Mac, Chime) Color protein by nma flexibility View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors 3D jmol viewer (NEW!)

Downloads and other analyses: Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph Download interpolation as gzip'ped NMR format PDB file Proflex Analysis Helical interaction analysis of first or last frame.

---

Statistics generated for this morph [ help page ]

Display percentiles for rankable statistics versus morph set: check 1

Rankable statistics: 2ndCoreCAs 115 2ndCoreRMS 11.1551 2ndCoreRMSpostrefitting 6.41556 AlignedCoreCAs 115 AlignedCoreRMS 1.18506 Max2ndCoreDeviation 21.2633 MaxCoreDeviation 2.72739 MaxOverallDeviation 21.2633 Min2ndCoreDeviation 2.22178 MinCoreDeviation 0.101947 MinOverallDeviation 0.101947 RMSoverall 7.9322 kappa 22.07 natoms 1820 nresidues 230 translation 23.5232

Other information: Hinge000X -1.82715 Hinge000Y 2.99524 Hinge000Z 10.2157 Hinge000res 91:114 Hinge000seq TYR VAL ASP PHE THR LEU PRO PHE THR ASP MET GLY LEU ALA VAL VAL THR ALA GLY GLY THR GLY LEU LYS Hinge000x0dist 20.0694 NHingeWindow 24 NHinges 1 TransX 13.4027 TransY -16.4157 TransZ 10.2094 hetero   inframes 2 inputchain0 A inputchain1 A inputframe0 webupload1.pdb inputframe1 webupload2.pdb max_x_or_y 33.122 movie_id 594526-7006 movie_type Yale nhetatoms   nhets 0 nresatoms 1820 outframes 10 prelimsscore nan private N protein_name glr14 submitted-by Joe A Kaczmarski submitted-date Sat Oct 24 20:18:09 PDT 2020 submitted-email kaczmarski.joe@gmail.com x0ToCentroidDistance 26.3533 x0X 15.9275 x0Y 7.89525 x0Z -19.4545

---

Alignment of Protein Structures from Amino Acids in their SEQRES decks:

View alignment as nicely formated Alscript page (PDF format)

1>P1;webupload2.pdb.....1.KLRVLVPAGNITPQILEVKTDFKTGVTAATGYCIDVFETSILPFNYEVEYIPWPGAINYKNYNDLVYTLYSQKDKYDAAVGDITITDNRSLYVDFTLPFT
2>P1;webupload1.pdb.....1.KLRVLVPAGNITPQILEVKTDFKTGVTAATGYCIDVFETSILPFNYEVEYIPWPGAINYKNYNDLVYTLYSQKDKYDAAVGDITITDNRSLYVDFTLPFT

1>P1;webupload2.pdb...101.DMGLAVVTAGGTGLKSNENIGFFSASIAANVVNDNPTFQGPRYKGLKTADDFTNALRNGTISFIVDEVPYVKLFVAKHPSEFVIVETESVTNGFGFAFQK
2>P1;webupload1.pdb...101.DMGLAVVTAGGTGLKSNENIGFFSASIAANVVNDNPTFQGPRYKGLKTADDFTNALRNGTISFIVDEVPYVKLFVAKHPSEFVIVETESVTNGFGFAFQK

1>P1;webupload2.pdb...201.GSPLVQKVSREIEKLRRTEKLKAIENWWFQ
2>P1;webupload1.pdb...201.GSPLVQKVSREIEKLRRTEKLKAIENWWFQ

---

Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu