hexokinase [488020-4931]

Representation Video Format Ribbon MultiGif CA trace Ball-and-Stick

---

Other visual representations: Create new custom MPEG of this morph Color protein by motion View interpolation animated in Protein Explorer (Rotate, color, render as desired. Requires PC/Mac, Chime) Color protein by nma flexibility View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors 3D jmol viewer (NEW!)

Downloads and other analyses: Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph Download interpolation as gzip'ped NMR format PDB file Proflex Analysis Helical interaction analysis of first or last frame.

---

Statistics generated for this morph [ help page ]

Display percentiles for rankable statistics versus morph set: check 1

Rankable statistics: 2ndCoreCAs 235 2ndCoreRMS 7.83459 2ndCoreRMSpostrefitting 4.02797 AlignedCoreCAs 235 AlignedCoreRMS 0.708764 Max2ndCoreDeviation 18.372 MaxCoreDeviation 1.15278 MaxOverallDeviation 18.372 Min2ndCoreDeviation 1.16955 MinCoreDeviation 0.0672167 MinOverallDeviation 0.0672167 RMSoverall 5.56251 kappa 15.4351 natoms 3771 nresidues 485 translation 9.18986

Other information: Hinge000X 9.98312 Hinge000Y 12.3343 Hinge000Z -16.6485 Hinge000res 83:106 Hinge000seq GLY GLY ASN HIS ASP PHE ASP THR THR GLN ASN LYS TYR ARG LEU PRO ASP HIS LEU ARG THR GLY THR SER Hinge000x0dist 27.5574 NHingeWindow 24 NHinges 1 TransX -1.80091 TransY 0.486327 TransZ -8.99855 hetero   inframes 2 inputchain0 A inputchain1 A inputframe0 3o80.pdb inputframe1 3o8m.pdb max_x_or_y 35.887 movie_id 488020-4931 movie_type Yale nhetatoms   nhets 0 nresatoms 3771 outframes 10 prelimsscore nan private N protein_name hexokinase submitted-by Margaret Franzen submitted-date Thu Feb 4 17:35:29 PST 2021 submitted-email franzen@msoe.edu x0ToCentroidDistance 22.9426 x0X -11.9625 x0Y -16.5113 x0Z -10.5185

---

Alignment of Protein Structures from Amino Acids in their SEQRES decks:

View alignment as nicely formated Alscript page (PDF format)

1>P1;3o8m.pdb.....1.MVRLGPKKPPARKGSMADVPANLMEQIHGLETLFTVSSEKMRSIVKHFISELDKGLSKKGGNIPMIPGWVVEYPTGKETGDFLALDLGGTNLRVVLVKLG
2>P1;3o80.pdb.....1.MVRLGPKKPPARKGSMADVPANLMEQIHGLETLFTVSSEKMRSIVKHFISELDKGLSKKGGNIPMIPGWVVEYPTGKETGDFLALDLGGTNLRVVLVKLG

1>P1;3o8m.pdb...101.GNHDFDTTQNKYRLPDHLRTGTSEQLWSFIAKCLKEFVDEWYPDGVSEPLPLGFTFSYPASQKKINSGVLQRWTKGFDIEGVEGHDVVPMLQEQIEKLNI
2>P1;3o80.pdb...101.GNHDFDTTQNKYRLPDHLRTGTSEQLWSFIAKCLKEFVDEWYPDGVSEPLPLGFTFSYPASQKKINSGVLQRWTKGFDIEGVEGHDVVPMLQEQIEKLNI

1>P1;3o8m.pdb...201.PINVVALINDTTGTLVASLYTDPQTKMGIIIGTGVNGAYYDVVSGIEKLEGLLPEDIGPDSPMAINCEYGSFDNEHLVLPRTKYDVIIDEESPRPGQQAF
2>P1;3o80.pdb...201.PINVVALINDTTGTLVASLYTDPQTKMGIIIGTGVNGAYYDVVSGIEKLEGLLPEDIGPDSPMAINCEYGSFDNEHLVLPRTKYDVIIDEESPRPGQQAF

1>P1;3o8m.pdb...301.EKMTSGYYLGEIMRLVLLDLYDSGFIFKDQDISKLKEAYVMDTSYPSKIEDDPFENLEDTDDLFKTNLNIETTVVERKLIRKLAELVGTRAARLTVCGVS
2>P1;3o80.pdb...301.EKMTSGYYLGEIMRLVLLDLYDSGFIFKDQDISKLKEAYVMDTSYPSKIEDDPFENLEDTDDLFKTNLNIETTVVERKLIRKLAELVGTRAARLTVCGVS

1>P1;3o8m.pdb...401.AICDKRGYKTAHIAADGSVFNRYPGYKEKAAQALKDIYNWDVEKMEDHPIQLVAAEDGSGVGAAIIACLTQKRLAAGKSVGIKGE
2>P1;3o80.pdb...401.AICDKRGYKTAHIAADGSVFNRYPGYKEKAAQALKDIYNWDVEKMEDHPIQLVAAEDGSGVGAAIIACLTQKRLAAGKSVGIKGE

---

Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu