Gi1 protein chain A [467609-12598]

Representation Video Format Ribbon MultiGif CA trace Ball-and-Stick

---

Other visual representations: Create new custom MPEG of this morph Color protein by motion View interpolation animated in Protein Explorer (Rotate, color, render as desired. Requires PC/Mac, Chime) Color protein by nma flexibility View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors 3D jmol viewer (NEW!)

Downloads and other analyses: Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph Download interpolation as gzip'ped NMR format PDB file Proflex Analysis Helical interaction analysis of first or last frame.

---

Statistics generated for this morph [ help page ]

Display percentiles for rankable statistics versus morph set: check 1

Rankable statistics: 2ndCoreCAs 88 2ndCoreRMS 3.66158 2ndCoreRMSpostrefitting 3.36213 AlignedCoreCAs 89 AlignedCoreRMS 0.586782 Max2ndCoreDeviation 8.77303 MaxCoreDeviation 0.93531 MaxOverallDeviation 8.77303 Min2ndCoreDeviation 0.945982 MinCoreDeviation 0.0751932 MinOverallDeviation 0.0751932 RMSoverall 2.61512 kappa 2.89852 natoms 2823 nresidues 353 translation 9.31531

Other information: Hinge000X 4.42802 Hinge000Y -9.73834 Hinge000Z 17.4874 Hinge000res 121:136 Hinge000seq PRO GLU TYR ALA GLY SER ASN THR TYR GLU GLU ALA ALA ALA TYR ILE Hinge000x0dist 104.088 NHingeWindow 16 NHinges 1 TransX 6.94933 TransY -6.19841 TransZ -0.248118 hetero   inframes 2 inputchain0 A inputchain1 A inputframe0 webupload1.pdb inputframe1 webupload2.pdb max_x_or_y 42.638 movie_id 467609-12598 movie_type Yale nhetatoms   nhets 0 nresatoms 2823 outframes 32 prelimsscore nan private N protein_name Gi1 protein chain A submitted-by Joel Hornby submitted-date Mon Aug 3 08:31:15 PDT 2020 submitted-email joel.hornby@outlook.com x0ToCentroidDistance 105.927 x0X -69.5733 x0Y -67.3473 x0Z -42.9479

---

Alignment of Protein Structures from Amino Acids in their SEQRES decks:

View alignment as nicely formated Alscript page (PDF format)

1>P1;webupload2.pdb.....1..GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAAR
2>P1;webupload1.pdb.....1.MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSAR

1>P1;webupload2.pdb...101.ADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFD
2>P1;webupload1.pdb...101.ADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFD

1>P1;webupload2.pdb...201.VGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
2>P1;webupload1.pdb...201.VGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA

1>P1;webupload2.pdb...301.AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
2>P1;webupload1.pdb...301.AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF

---

Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu