![]() |
HexoKinase [446862-24268]
Other visual representations: Create new custom MPEG of this morph Color protein by motion View interpolation animated in Protein Explorer
(Rotate, color, render as desired. Requires PC/Mac, Chime)Color protein by nma flexibility View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors 3D jmol viewer (NEW!)
Downloads and other analyses: Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph Download interpolation as gzip'ped NMR format PDB file Proflex Analysis Helical interaction analysis of first or last frame.
Statistics generated for this morph [ help page ]
Rankable statistics: 2ndCoreCAs 148 2ndCoreRMS 7.01472 2ndCoreRMSpostrefitting 2.17811 AlignedCoreCAs 149 AlignedCoreRMS 0.274662 Max2ndCoreDeviation 12.9691 MaxCoreDeviation 0.610883 MaxOverallDeviation 12.9691 Min2ndCoreDeviation 0.612149 MinCoreDeviation 0.024668 MinOverallDeviation 0.024668 RMSoverall 4.95562 kappa 19.651 natoms 2257 nresidues 299 translation 15.401
Other information: Hinge000X -10.9482 Hinge000Y -13.6507 Hinge000Z 3.86413 Hinge000res 117:128 Hinge000seq SER VAL VAL GLU GLY TYR ASN GLY LYS GLU PHE LEU Hinge000x0dist 53.8803 Hinge001X 6.25429 Hinge001Y -1.72366 Hinge001Z 9.43663 Hinge001res 134:145 Hinge001seq GLY TRP LEU LEU SER ASP ASP GLY SER ALA TYR TRP Hinge001x0dist 36.6807 NHingeWindow 12 NHinges 2 TransX -2.60606 TransY -5.29292 TransZ 14.2261 hetero   inframes 2 inputchain0 A inputchain1 A inputframe0 2e2n.pdb inputframe1 2e2q.pdb max_x_or_y 35.734 movie_id 446862-24268 movie_type Yale nhetatoms   nhets 0 nresatoms 2257 outframes 10 prelimsscore nan private N protein_name HexoKinase submitted-by Evan Kantrowitz submitted-date Sun Nov 15 07:13:08 PST 2020 submitted-email evan.kantrowitz@bc.edu x0ToCentroidDistance 44.6577 x0X -42.1418 x0Y 8.94472 x0Z -11.7633
Alignment of Protein Structures from Amino Acids in their SEQRES decks:
View alignment as nicely formated Alscript page (PDF format)
1>P1;2e2q.pdb.....1.MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIAL 2>P1;2e2n.pdb.....1.MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIAL 1>P1;2e2q.pdb...101.FAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVAS 2>P1;2e2n.pdb...101.FAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVAS 1>P1;2e2q.pdb...201.IAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLISD 2>P1;2e2n.pdb...201.IAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLISD
![]()
![]()
![]()
Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu