![]() |
SmbA [392519-25362]
Other visual representations: Create new custom MPEG of this morph Color protein by motion View interpolation animated in Protein Explorer
(Rotate, color, render as desired. Requires PC/Mac, Chime)Color protein by nma flexibility View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors 3D jmol viewer (NEW!)
Downloads and other analyses: Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph Download interpolation as gzip'ped NMR format PDB file Proflex Analysis Helical interaction analysis of first or last frame.
Statistics generated for this morph [ help page ]
Rankable statistics: 2ndCoreCAs 141 2ndCoreRMS 6.90066 2ndCoreRMSpostrefitting 5.86369 AlignedCoreCAs 142 AlignedCoreRMS 0.231152 Max2ndCoreDeviation 29.3486 MaxCoreDeviation 0.352705 MaxOverallDeviation 29.3486 Min2ndCoreDeviation 0.359713 MinCoreDeviation 0.0477948 MinOverallDeviation 0.0477948 RMSoverall 4.87362 kappa 8.69181 natoms 2322 nresidues 298 translation 0.405244
Other information: Hinge000X -3.69359 Hinge000Y -1.5181 Hinge000Z 8.47777 Hinge000res 217:230 Hinge000seq ALA LEU THR GLU PRO SER LEU ALA THR VAL ARG VAL THR ALA Hinge000x0dist 12.9148 NHingeWindow 14 NHinges 1 TransX -0.148568 TransY -0.0306264 TransZ 0.375782 hetero   inframes 2 inputchain0 A inputchain1 A inputframe0 webupload1.pdb inputframe1 webupload2.pdb max_x_or_y 57.48 movie_id 392519-25362 movie_type Yale nhetatoms   nhets 0 nresatoms 2322 outframes 10 prelimsscore nan private N protein_name SmbA submitted-by Badri Dubey submitted-date Tue Nov 3 01:44:24 PST 2020 submitted-email bndubeyhhu@gmail.com x0ToCentroidDistance 16.1316 x0X -5.91339 x0Y -4.98045 x0Z -14.1582
Alignment of Protein Structures from Amino Acids in their SEQRES decks:
View alignment as nicely formated Alscript page (PDF format)
1>P1;webupload2.pdb.....1..RYRPFGSTGVAVSALTLRLADNPRLRANDWRALVFTALENGVNSFQIDGDAPELLKGAGEAFASVERHLLFLTWRLRGDAKQLGPHTLDALKRSAFEGL 2>P1;webupload1.pdb.....1.MRYRPFGSTGVAVSALTLRLADNPRLRANDWRALVFTALENGVNSFQIDGDAPELLKGAGEAFASVERHLLFLTWRLRGDAKQLGPHTLDALKRSAFEGL 1>P1;webupload2.pdb...101.SLDYLDLLLINDPQSASLPXAFESGLQDLQKGRALRGLGVASRGDIDPGLLANDLVTAVSSPYNLSSGWAERHRIRQASQNNFAVIGEDFWPQALREVXX 2>P1;webupload1.pdb...101.SLDYLDLLLINDPQSASLPMAFESGLQDLQKGRALRGLGVASRGDIDPGLLANDLVTAVSSPYNLSSGWAERHRIRQASQNNFAVIGEDFWPQALREVAD 1>P1;webupload2.pdb...201.XXXXKPSFWQRRTDPLADVGGYEFLTNTPGWSAEDICLGYALTEPSLATVRVTADNRQEIERLAAVVERDLPTGVCAQIEXARFSAQEREKAARRPKLAA 2>P1;webupload1.pdb...201.KAPPKPSFWQRRTDPLADVGGYEFLTNTPGWSAEDICLGYALTEPSLATVRVTADNRQEIERLAAVVERDLPTGVCAQIEMARFSAQEREKAARRPKLAA 1>P1;webupload2.pdb...301.ALEHHHH.. 2>P1;webupload1.pdb...301.ALEHHHHHH
![]()
![]()
![]()
Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu