oxygen [340646-19666]
Other visual representations: Create new custom MPEG of this morph Color protein by motion View interpolation animated in Protein Explorer
(Rotate, color, render as desired. Requires PC/Mac, Chime)Color protein by nma flexibility View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors 3D jmol viewer (NEW!)
Downloads and other analyses: Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph Download interpolation as gzip'ped NMR format PDB file Proflex Analysis Helical interaction analysis of first or last frame.
Statistics generated for this morph [ help page ]
Rankable statistics: 2ndCoreCAs 70 2ndCoreRMS 1.11436 2ndCoreRMSpostrefitting 0.901395 AlignedCoreCAs 71 AlignedCoreRMS 0.25187 Max2ndCoreDeviation 5.04738 MaxCoreDeviation 0.387203 MaxOverallDeviation 5.04738 Min2ndCoreDeviation 0.401818 MinCoreDeviation 0.0815872 MinOverallDeviation 0.0815872 RMSoverall 0.805254 kappa 2.32758 natoms 1069 nresidues 141 translation 1.45833
Other information: Hinge000X 8.71917 Hinge000Y 3.87283 Hinge000Z -1.64791 Hinge000res 85:108 Hinge000seq LEU HIS ALA HIS LYS LEU ARG VAL ASP PRO VAL ASN PHE LYS LEU LEU SER HIS CYS LEU LEU VAL THR LEU Hinge000x0dist 32.9575 NHingeWindow 24 NHinges 1 TransX 0.275319 TransY 1.04461 TransZ -0.979646 hetero   inframes 2 inputchain0 A inputchain1 A inputframe0 webupload1.pdb inputframe1 webupload2.pdb max_x_or_y 22.672 movie_id 340646-19666 movie_type Yale nhetatoms   nhets 0 nresatoms 1069 outframes 30 prelimsscore nan private N protein_name oxygen submitted-by Meihao Sun submitted-date Sun May 24 10:17:52 PDT 2020 submitted-email mhsun@zjnu.cn x0ToCentroidDistance 34.2139 x0X -6.58096 x0Y -19.7383 x0Z -27.1603
Alignment of Protein Structures from Amino Acids in their SEQRES decks:
View alignment as nicely formated Alscript page (PDF format)
1>P1;webupload2.pdb.....1.VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKL 2>P1;webupload1.pdb.....1.VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKL 1>P1;webupload2.pdb...101.LSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 2>P1;webupload1.pdb...101.LSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu