H [305102-29411]

Representation Video Format Ribbon MultiGif CA trace Ball-and-Stick

---

Other visual representations: Create new custom MPEG of this morph Color protein by motion View interpolation animated in Protein Explorer (Rotate, color, render as desired. Requires PC/Mac, Chime) Color protein by nma flexibility View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors 3D jmol viewer (NEW!)

Downloads and other analyses: Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph Download interpolation as gzip'ped NMR format PDB file Proflex Analysis Helical interaction analysis of first or last frame.

---

Statistics generated for this morph [ help page ]

Display percentiles for rankable statistics versus morph set: check 1

Rankable statistics: 2ndCoreCAs 98 2ndCoreRMS 7.49733 2ndCoreRMSpostrefitting 3.82933 AlignedCoreCAs 99 AlignedCoreRMS 0.816273 Max2ndCoreDeviation 13.0545 MaxCoreDeviation 2.54057 MaxOverallDeviation 13.0545 Min2ndCoreDeviation 2.8437 MinCoreDeviation 0.0550323 MinOverallDeviation 0.0550323 RMSoverall 5.31951 kappa 22.6719 natoms 3208 nresidues 415 translation 16.7408

Other information: Hinge000X -6.30272 Hinge000Y 9.52384 Hinge000Z 4.38806 Hinge000res 89:112 Hinge000seq ARG ALA LEU ILE THR VAL LEU VAL GLU ARG LEU HIS ASN HIS PRO ASP GLY TRP ALA LEU LYS VAL LEU THR Hinge000x0dist 13.0424 Hinge001X 18.3383 Hinge001Y -13.1997 Hinge001Z 0.959558 Hinge001res 124:147 Hinge001seq LEU ARG GLY LEU LEU GLY GLN ILE ASN LEU PRO ALA ASP HIS PRO THR THR LEU ARG SER ALA ILE SER VAL Hinge001x0dist 25.4537 NHingeWindow 24 NHinges 2 TransX -2.90826 TransY 10.2921 TransZ -12.879 hetero   inframes 2 inputchain0 A inputchain1 A inputframe0 webupload1.pdb inputframe1 webupload2.pdb max_x_or_y 31.808 movie_id 305102-29411 movie_type Yale nhetatoms   nhets 0 nresatoms 3208 outframes 10 prelimsscore nan private N protein_name H submitted-by NANNAN submitted-date Sat Oct 10 03:41:13 PDT 2020 submitted-email nancy_zhangnn@foxmail.com x0ToCentroidDistance 12.6728 x0X -6.51404 x0Y -8.61674 x0Z -6.62706

---

Alignment of Protein Structures from Amino Acids in their SEQRES decks:

View alignment as nicely formated Alscript page (PDF format)

1>P1;webupload2.pdb.....1.SRLDGQATRLQILEKAGELFAEQGLANTTSKQICERSQANSAAVNYHFVNKEGLYRAVLLEAHARLVQLETLVSLNERPGSPQDKLRALITVLVERLHNH
2>P1;webupload1.pdb.....1.SRLDGQATRLQILEKAGELFAEQGLANTTSKQICERSQANSAAVNYHFVNKEGLYRAVLLEAHARLVQLETLVSLNERPGSPQDKLRALITVLVERLHNH

1>P1;webupload2.pdb...101.PDGWALKVLTREVLSPSPEFEVVLKEQSFPKAHILRGLLGQIMNLPADHPTTLRSAISVFAPCLFLLIAHQPLKQHVLQGLSLEPQGLIDHMMSYALGGL
2>P1;webupload1.pdb...101.PDGWALKVLTREVLSPXXXXXXXXXXXXXPKAHILRGLLGQIXNLPADHPTTLRSAISVFAPCLFLLIAHQPLKQHVLQGLSLEPQGLIDHXXSYALGGL

1>P1;webupload2.pdb...201.QAVAATAHDAA..........TRLQILEKAGELFAEQGLANTTSKQICERSQANSAAVNYHFVNKEGLYRAVLLEAHARLVQLETLVSLNERPGSPQDKL
2>P1;webupload1.pdb...201.QAVAATAHDAASRASRLDGQATRLQILEKAGELFAEQGLANTTSKQICERSQANSAAVNYHFVNKEGLYRAVLLEAHARLVQLETLVSLNERPGSPQDKL

1>P1;webupload2.pdb...301.RALITVLVERLHNHPDGWALKVLTREVLSPSPEFEVVLKEQSFPKAHILRGLLGQIMNLPADHPTTLRSAISVFAPCLFLLIAHQPLKQHVLQGLSLEPQ
2>P1;webupload1.pdb...301.RALITVLVERLHNHPDGWALKVLTREVLSPSXXXXVVLKEQSFPKAHILRGLLGQIXNLPADHPTTLRSAISVFAPCLFLLIAHQPLXXXXXQGLSLEPQ

1>P1;webupload2.pdb...401.GLIDHMMSYALGGLQAVAATAHDAA
2>P1;webupload1.pdb...401.GLIDHXXSYALGGLQAVAATAHD..

---

Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu